A place where you can get some breaking news, analysis, biographies and interviews from an alternative, relaxed and cool perspective.

1.67 Rating by CuteStat

newsfactor.us is 9 years 7 months old. It is a domain having us extension. It has a global traffic rank of #6695282 in the world. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, newsfactor.us is SAFE to browse.

PageSpeed Score
84
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: 72
Daily Pageviews: 144

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 6,695,282
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

104.28.23.33

Hosted Country:

United States of America US

Location Latitude:

37.751

Location Longitude:

-97.822
NewsFactor - A place where you can get some breaking news, analysis, biographies and interviews from an alternative, relaxed and cool perspective.

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 2 H2 Headings: 3
H3 Headings: Not Applicable H4 Headings: 9
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 10
Google Adsense: Not Applicable Google Analytics: UA-55823579-1

Websites Hosted on Same IP (i.e. 104.28.23.33)

Paul Irish

- paulirish.com
310,632 $ 28,620.00


سهامداران پدیده شاندیز و پدیده کیش

- shandizstocks.ir

سایت سهامداران پدیده شاندیز و پدیده کیش به همراه آخرین اخبار درباره پروژه های شرکت پدیده شاندیز محلی مناسب برای تمام افرای که سهام پدیده شاندیز را دارند

30,640 $ 271,440.00

uevf.org: SAG Awards 2020 Film Nominations: From 'Bombshell' to 'Paras

- uevf.org

Get the Latest News, updates, publications and the newest posts from sources uevf.org. SAG Awards 2020 Film Nominations: From 'Bombshell' to 'Parasite,' These Are the Ones to Beat

Not Applicable $ 8.95

Traffic Ticket Attorneys | York & Lancaster, PA | 717 889 7100

- centralpennsylvaniatrafficlawyers.com

Fight That Traffic Ticket! Whether it is a Speeding Ticket or another violation our experienced traffic lawyers will protect your right to drive and right to work

Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Fri, 17 Oct 2014 08:57:55 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
X-CF-Powered-By: WP 1.3.14
Last-Modified: Fri, 17 Oct 2014 08:44:39 GMT
Pragma: public
Cache-Control: max-age=2804, public
X-Powered-By: W3 Total Cache/0.9.4
Vary: Accept-Encoding,User-Agent
X-Pingback: http://newsfactor.us/xmlrpc.php
Server: cloudflare-nginx
CF-RAY: 17ab4a9751c80d25-ATL
Content-Encoding: gzip

Domain Information

Domain Registrar: Camelot 97, LLC
Registration Date: Sep 29, 2014, 12:00 AM 9 years 7 months 2 weeks ago
Last Modified: Sep 30, 2014, 12:00 AM 9 years 7 months 2 weeks ago
Expiration Date: Sep 28, 2015, 12:00 AM 8 years 7 months 2 weeks ago
Domain Status:
clientDeleteProhibited
clientRenewProhibited
clientTransferProhibited
clientUpdateProhibited
Owner's E-Mail: jsladden@googlemail.com

Domain Nameserver Information

Host IP Address Country
kim.ns.cloudflare.com 173.245.58.126 United States of America United States of America
dave.ns.cloudflare.com 172.64.33.109 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
newsfactor.us A 201 IP: 104.28.22.33
newsfactor.us A 201 IP: 104.28.23.33
newsfactor.us NS 21599 Target: kim.ns.cloudflare.com
newsfactor.us NS 21599 Target: dave.ns.cloudflare.com
newsfactor.us SOA 21599 MNAME: dave.ns.cloudflare.com
RNAME: dns.cloudflare.com
Serial: 2016413715
Refresh: 10000
Retry: 2400
Expire: 604800
Minimum TTL: 3600
newsfactor.us MX 299 Target: mx.newsfactor.us

Similarly Ranked Websites

Mobilité durable : votre solution d'entreprise clé-en-main | Coovia

- coovia.fr

Faites de la mobilité d'entreprise un levier de performance de votre entreprise. Améliorer la qualité de vie au travail de vos collaborateurs, développez votre marque employeur, une meilleure accessibilité de votre site, désengorgez vos parkings...

6,695,286 $ 8.95

Ìîòîðíîå ìàñëî Mobil — êóïèòü àâòîìîáèëüíîå ìàñëî Ìîáèë îïòîì ïî öåíàì

- oiltrade.ru

Îéë Òðåéä Êîìïàíèè -îôèöèàëüíûé äèñòðèáüþòîð Mobil. Íàëè÷èå ïîëíîãî àññîðòèìåíòà è äîñòàòî÷íîãî ñêëàäñêîãî çàïàñà ñìàçî÷íûõ ìàòåðèàëîâ Mobil. Ãàðàíòèÿ êà÷åñòâà, âñå ïîñòàâëÿåìûå ñìàçî÷íûå ìàòåðèàëû ñåðòèôèöèðîâàíû.

6,695,287 $ 240.00

Home - Sigui Furniture

- siguifurniture.com
6,695,288 $ 240.00

YourProxy.Com // Sponsored by FreeProxyTemplates.com

- proxyspeed.top

Feel free to browse the internet at school with YourProxy.com to unblock websites like Myspace, Bebo, Facebook, Friendster, hi5 and more! Designed by FreeProxyTemplates.com

6,695,295 $ 8.95

Welcome to Arrowpoint Technologies

- arrowpointtechnologies.com
6,695,298 $ 240.00

Full WHOIS Lookup

Domain Name: NEWSFACTOR.US
Domain ID: D46831145-US
Sponsoring Registrar: GODADDY.COM, INC.
Sponsoring Registrar IANA ID: 146
Registrar URL (registration services): whois.godaddy.com
Domain Status: clientDeleteProhibited
Domain Status: clientRenewProhibited
Domain Status: clientTransferProhibited
Domain Status: clientUpdateProhibited
Variant: NEWSFACTOR.US
Registrant ID: CR177630778
Registrant Name: Karina Marin
Registrant Address1: 727 E. San Ysidro Blvd. #1318
Registrant City: San Ysidro
Registrant State/Province: California
Registrant Postal Code: 92173
Registrant Country: United States
Registrant Country Code: US
Registrant Phone Number: +1.9174608529
Registrant Email: marinkarina@gmail.com
Registrant Application Purpose: P1
Registrant Nexus Category: C11
Administrative Contact ID: CR177630780
Administrative Contact Name: Karina Marin
Administrative Contact Address1: 727 E. San Ysidro Blvd. #1318
Administrative Contact City: San Ysidro
Administrative Contact State/Province: California
Administrative Contact Postal Code: 92173
Administrative Contact Country: United States
Administrative Contact Country Code: US
Administrative Contact Phone Number: +1.9174608529
Administrative Contact Email: marinkarina@gmail.com
Administrative Application Purpose: P1
Administrative Nexus Category: C11
Billing Contact ID: CR177630781
Billing Contact Name: Karina Marin
Billing Contact Address1: 727 E. San Ysidro Blvd. #1318
Billing Contact City: San Ysidro
Billing Contact State/Province: California
Billing Contact Postal Code: 92173
Billing Contact Country: United States
Billing Contact Country Code: US
Billing Contact Phone Number: +1.9174608529
Billing Contact Email: marinkarina@gmail.com
Billing Application Purpose: P1
Billing Nexus Category: C11
Technical Contact ID: CR177630779
Technical Contact Name: Karina Marin
Technical Contact Address1: 727 E. San Ysidro Blvd. #1318
Technical Contact City: San Ysidro
Technical Contact State/Province: California
Technical Contact Postal Code: 92173
Technical Contact Country: United States
Technical Contact Country Code: US
Technical Contact Phone Number: +1.9174608529
Technical Contact Email: marinkarina@gmail.com
Technical Application Purpose: P1
Technical Nexus Category: C11
Name Server: KIM.NS.CLOUDFLARE.COM
Name Server: DAVE.NS.CLOUDFLARE.COM
Created by Registrar: GODADDY.COM, INC.
Last Updated by Registrar: GODADDY.COM, INC.
Domain Registration Date: Mon Sep 29 19:42:03 GMT 2014
Domain Expiration Date: Mon Sep 28 23:59:59 GMT 2015
Domain Last Updated Date: Tue Sep 30 03:03:48 GMT 2014
DNSSEC: false

>>>> Whois database was last updated on: Fri Oct 17 08:54:32 GMT 2014